PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00377.70
Common NameJCGZ_04505, JHL18I08.14, LOC105633874
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family SRS
Protein Properties Length: 315aa    MW: 34715.2 Da    PI: 8.4742
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00377.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702225.59.8e-70922503154
         DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrel.......kskkqs 84 
                     g+++CqdCGnqakkdCah RCRtCCksrgf+C+thvkstWvpaakrrerqqql+a+++++++++       +       +         ++++  
  Jcr4S00377.70  92 GGGMNCQDCGNQAKKDCAHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLSALQQQQQHQEqqhqqqqQ-------QFRgenpkrqRENQGG 180
                    5789***************************************************999988877745444331.......2212233333555666 PP

         DUF702  85 alsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                    a s + +  +++++ le++++P+ev+s+avfrcv+vs++dd++e++aYqtav+igGh+f+G+LydqG+++
  Jcr4S00377.70 181 APSLACTRLGTTTSGLEVAHFPPEVNSPAVFRCVKVSAMDDADEQFAYQTAVNIGGHMFRGLLYDQGPDS 250
                    6666666677778889****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.0E-6694249IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.9E-2796138IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.6E-25200248IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAGWFYLSGR EGAVTSKQGE DKNQENNLFL YRSNNEQIYN KGFEIWPQYY HQQQNMNNYS  60
SFGVGPSRRS FSDESSRSGF TVMRQGGLGG GGGGMNCQDC GNQAKKDCAH LRCRTCCKSR  120
GFQCQTHVKS TWVPAAKRRE RQQQLSALQQ QQQHQEQQHQ QQQQQFRGEN PKRQRENQGG  180
APSLACTRLG TTTSGLEVAH FPPEVNSPAV FRCVKVSAMD DADEQFAYQT AVNIGGHMFR  240
GLLYDQGPDS RYTSGGESSS GGAQQLNLIT AATTSTEATP SNQQGTGALI DPSSLYPAPL  300
NAFIAGTQFF PPPRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0119660.0AP011966.1 Jatropha curcas DNA, clone: JHL18I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071961.10.0PREDICTED: protein SHI RELATED SEQUENCE 1
SwissprotQ9LQZ51e-95SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLE6NU700.0E6NU70_JATCU; JHL18I08.14 protein
STRINGPOPTR_0002s03000.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.12e-81SHI-related sequence 5
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]